<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G32 G32-AFMC17 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19I, M36V, R41K, D60E, L63P, H69K, V82I, L89M, I93L  
>G32-AFMC17| codons 1-99
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S3I, T7S, V35T, E36A, T39D, S48T, K49R, V60I, D121Y, K122E, I135T, I159V, S162A, K173A, D177E, T200A, Q207E, V245Q, A272P, K281R, E291D, V292I, I293V, G335D, K347E, R356K, G359T D17A
>G32-AFMC17| codons 1-366
PIIPIESVPVKLKPGMAGPKVKQWPLTEEKIKALTAICDEMEKEGKITRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAVFQASMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFENLKTGKYAKMRTA
HTNDVK

References
Author Title Citation
Lall, M Profile of primary resistance in HIV-1-infected treatment-naive individuals from western India. ARHR, 2008