<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, I13V, L63P, I64V, A71V, V77I  
>LPV13BL| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKVISTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
De Meyer, S Characterization of virologic failure patients on darunavir/ritonavir in treatment-experienced patients. AIDS, 2009