<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 78
2 DDI 43
3 DDC 13
4 D4T 30
5 AZT+D4T 18
6 3TC+AZT+IDV 52
7 D4T+DDI+NVP 19
8 3TC+D4T+RTV+SQV 58
9 3TC+DDI+EFV+RTV+SQV 17
10 3TC+RTV+SQV 45
11 None 34
12 ABC+DDI+LPV 11
13 ABC+APV+DDI+LPV 17
14 ABC+DDI+LPV 45
15 3TC+APV+DDI+LPV+T20 14
16 3TC+DDI+LPV+T20 108
17 3TC+AZT+LPV 18
18 3TC+AZT+LPV+T20 36
19 3TC+AZT+LPV 9
20 3TC+LPV 14
21 3TC+RTV+T20+TPV 1
22 None 1
23 3TC+RTV+T20+TPV 3
24 3TC+LPV 57
25 3TC+DDI+DRV+RTV+T20 8
26 3TC+DDI+DRV+RTV 5
27 3TC+LPV 48
28 3TC+DRV+ETR+RAL+MVC+RTV 1

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14KR, R20K, I72V, L101I, I113L, G193E, I203IM, S230N, D278A  
>CA124207| codons 1-288
FLDGIDKAQEEHERYHSNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTLHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGADCVASRQDED

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011