<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 14
3 DDI 27
4 D4T 21
5 3TC+AZT 58
6 3TC+AZT+IDV 48
7 D4T+NFV 25
8 DDC+NFV+RTV+SQV 16
9 3TC+RTV+SQV 5
10 ABC+EFV+RTV+SQV 44
11 ABC+APV+D4T+RTV 37
12 3TC+EFV+NVP 15
13 3TC+EFV+LPV+NVP 56
14 APV+D4T+DDI+IDV 49
15 EFV+NVP+TDF 65
16 3TC+ABC+AZT+LPV+SQV+TDF 31
17 3TC+ABC+AZT+RTV+TDF+TPV 104
18 ATV+FTC+RTV+T20+TDF 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K7R, S17N, L101I, K111Q, T206S, D256E  
>CA124203| codons 1-288
FLDGIDRAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVQTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54IV, I84V, L90M L10F, V11I, L33F, G73S, L89V T12P, I13V, I15V, L19P, K20T, E35G, M36I, I62V, L63P, K70T, A71I, P79A  
>CA71564| codons 1-99
PQITLWQRPFIPVKVGGQPTEALLDTGADDTIFEGINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHTIISTVLVGATPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y A62V, T69G L100I, K103N   K43KE, K64R, V111VI, K122E, I135T, S162Y, M164L, H208L, R211K, H221HY, L228H, V245E, A272P, K277R  
>CA71565| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FVIRKKDSGKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSLTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQLLWKWGFYTPDKKYQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011