<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2090 CA12416 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 ABC+ADV+IDV+NVP 92
3 3TC+AZT+EFV+RTV+SQV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V A62V, V75I, T215V, K219Q K103T, V106A, Y188L   V35R, K122E, I135T, G196E, Q207E, F214L, E224D, A288T  
>CA12416| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPV
FVIKKKNSDRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKTKSATVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIEQHRTKIEELREHLLRWGLVTPDQKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKTLTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, M36I, N37D, I62V, L63P, A71V, T74S, I85IV, I93L  
>CA12696| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGSVLVGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005