<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1833 CA12414 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 D4T 87
3 3TC+AZT+IDV 42
4 3TC+D4T+IDV 26
5 DDC+NFV+NVP 47
6 DDC+RTV+SQV 31
7 ABC+EFV+RTV+SQV 33

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, M184V, L210W, T215Y   Y181C, G190A A98G K20R, T39E, E44D, V118I, K122E, I135T, G196E, E203K, R211K, A272S, V276T, K277R, Q278E, L283I, I293V, E297K  
>CA12414| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIKELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKTRELCKLIRGTKALTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, V82A   L10I, T12S, I13V, G16E, L19V, L63T, A71V, I72T, I93L  
>CA12670| codons 1-99
PQITLWQRPIVSVKIEGQVKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFIKVRQYD
QITIEICGHKVTGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009