<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5102 CA12385 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 96
2 AZT+DDC 31
3 3TC+AZT 92
4 D4T+DDC+NFV 26
5 3TC+AZT 68

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     K20R, V35X, K43E, E44A, A98S, V118I, K122KE, G196GE, H208Y, R211K, V245K, D250E, S251SC  
>CA12385| codons 1-277
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALXEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKECWTVNDIQKLVGKLNWASQIYAGIKVK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, V77I, I93L  
>CA12664| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005