<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5076 CA12358 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 52
2 AZT+DDC 61
3 3TC+AZT 78
4 D4T+DDI+NVP 106

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151LM, T215F F116Y, K219Q K103NS, Y181C   K20R, T27S, V35I, V60I, R83K, I135T, I167IV, Q197E, R211K, D218E, K259KE, A272P K277KE
>CA12358| codons 1-287
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPLGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
CQYMDDLYVGSDLEIGEHRTKIEELRQHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQELVGKLNWASQIYPGIKVEQLCKLLRGTK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5X, L10X, L19I, E35D, N37S, L63P, I72V, V77I, I93L  
>CA12641| codons 1-99
PQITXWQRPXVTIKIGGQIKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009