<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5074 CA12355 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC 106

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q     E6D, K20R, D123E, F171Y, V179I, T200I, R211K, F214L, L228H, D250E, A272P, R284K, T286TA, I293V, P294Q  
>CA12355| codons 1-298
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIII
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLKWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVVQLTEE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39Q, R41RK, L63P  
>CA12638| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLQGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001