<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA38006 CA123504 U.S. 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 66

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   L100I, K103N   V35I, S48T, K104KR, K122E, D177E, I178M, R211K, D250E, A272P, K277R, Q278QH, E297Q  
>CA123504| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVIPLTQEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, M36I, K43R, I62V, L63P  
>CA123503| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012