<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8346 CA123387 U.S. 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+SQV 39
2 3TC+D4T+IDV 165
3 3TC+D4T+IDV+RTV 156
4 Unknown 298

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A L33F, Q58E L10I, I13IV, D60E, L63P, A71V, V77I, T91A  
>CA123387| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIVGIGGFSKVREYE
QIPIEICGHKVIGTVLIGPTPANIIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y K219KN     P4S, A98S, V118I, K122E, D123E, I135V, K166R, R211K, I244IV, A272P, K277R, T286A, V292I, I293V, E297Q  
>CA123388| codons 1-299
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPVVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIVPLTQEA

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010