<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1257 CA123363 U.S. 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+DDC 8
3 3TC+AZT 44
4 3TC+AZT+SQV 35
5 3TC+D4T+IDV 37
6 3TC+D4T+IDV+NVP 189
7 3TC+D4T+LPV+NVP 43
8 3TC+D4T+LPV+NVP+TDF 239
9 Unknown 105

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, V11I, G73S T12P, I13V, I15V, L19P, K20I, E35G, M36I, L63P, A71V, I72L, I93L  
>CA123363| codons 1-99
PQITLWQRPFIPVKVGGQPIEALLDTGADDTVLEGINLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVLSTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219DN Y181C, G190A K101H T39TA, K43Q, E44D, K49R, V60I, V106VI, V118I, K122E, D123E, I135T, T200A, D218E, D250E, L283I, R284K, I293V, P294Q, E297A  
>CA123364| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEQDGKISRIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSITVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRAKIEELRQHLWRWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIKGTKALTEVVQLTAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010