<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5056 CA12336 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 117
2 3TC+AZT 74
3 D4T+DDI+NFV 78
4 EFV+RTV+SQV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W D67G, T215AD K103N   T39A, E44D, S68G, K102R, I142V, V179I, G196E, R211T, D237E  
>CA12336| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKGGDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWTWGFATPDKKHQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S, L90M   L10V, R41K, Q61H, L63P, K70R, V77I  
>CA12620| codons 10-99
VVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYDHIPIEICGH
RAIGTVLIGPTPVNIIGRSLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005