<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
56 10371631 Switzerland 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, V60I, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, Q207E I47IV
>10371631| codons 29-224
EKIKALTEICTDMEKEGKVSKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRSKNPEIIIYQYMDDLYVGSDLEIGQHRTKIEELREH
LLRWGFTTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, E35D, M36I, R41K, R57K, H69K, L89M  
>10371631| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007