<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3935 CA12327 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 38
2 D4T+RTV+SQV 31
3 3TC+D4T+IDV 153

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219Q     K20R, V21I, T39A, E44D, V60I, K103R, V118I, K122E, I132IV, I135T, K173R, Q174K, N175Y, G196E, H208Y, R211K, D218E, A272P, I293V L149LP
>CA12327| codons 1-302
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTVPSTNNETPGIRYQYNVPPQGWKGSPAIFQSSMTKILEPFRRKYPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M G73S L10I, L63P, A71V, V77I, I93L  
>CA12610| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVISTVLIGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009