<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
140 5868658 Switzerland 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NRTI+PI+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12M, I15V, R41K, L63C, V77I, I93L  
>5868658| codons 1-99
PQITLWQRPLVMIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007