<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
95 662081 Switzerland 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K104R, K122P, E138A, I142T, A158S, S162C, V179I, T200A, R211K  
>662081| codons 1-224
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNATPGTRYQYNVLPQGWKGSPSIFQCSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10LF, L33LF, N88ND K14R, N37D, R57RK, L63S, A71AV T31TI
>662081| codons 1-99
PQITLWQRPFVTIRIGGQLKEALLDTGADNIVFEEMDLPGRWKPKMIGGIGGFIKVKQYD
QISIEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007