<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 662309 Switzerland 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V T215S     V60I, K122E, D123E, I132V, I135T, T165I, D177E, G196E, I202V  
>662309| codons 1-224
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFSTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N K43T I15V, L19Q, E35D, N37E, L63P  
>662309| codons 1-99
PQITLWQRPLVTIKVGGQQKEALLDTGADNTVLEDMELPGRWTPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007