<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3 10371422 Switzerland 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82M L24I, L33F L10V, I13V, K20R, E35D, M36I, N37DE, K55R, R57K, D60E, I62V, L63P, V75I, L89M, T91S  
>10371422| codons 1-99
PQITLWQRPVVTVKIGGQLREALIDTGADDTVFEDIELPGRWKPKIIGGIGGFVRVKQYE
QVPIEICGHKAIGTIVVGPTPMNIIGRNMLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y K219R G190A   V35R, T39A, K43E, E44ED, K102H, V118I, K122E, E169D, V189I, T200E, E203K, Q207E, H208Y, R211K  
>10371422| codons 29-224
EKIKALREICAELEEDGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFW
EVQLGIPHPAGLKHKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILDPFRKQNPDIVIYQYVDDLYIASDLEIGQHREKIKELREY
LWKWGFYTPDRKHQKE

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007