<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
53 700437 Switzerland 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V21VI, E28EK, V35T, V60I, K122E, D123S, T139TK, K173T, Q174K, D177E, I178M, T200A, Q207E, R211RK  
>700437| codons 1-224
PISPIETVPVKLKPGMDGPKIKQWPLTKEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90LM   I13V, K14R, K20I, L33V, E35Q, M36I, R41K, R57K, D60DE, C67E, H69K, V82I, L89I  
>700437| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVVEQINLPGKWKPKMIGGIGGFVKVKQYE
QILIEIEGKKAIGTVLVGPTPINIIGRNIMTQIGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007