<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5034 CA12308 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC 25
2 D4T+ 3TC+ NFV+ NVP 17
3 D4T+ 3TC+ NVP 86
4 ABC+ DDI+ APV+ RTV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K101E, G190A   E28EK, K122E, I142V, S162H, V179VI, G196E, T200A, D250E, P294T  
>CA12308| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPDIII
YQYVDDLYVASDLEIEQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVITLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57K, I62V, L63P, I64IL, V77I, I93L  
>CA12590| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QVPLEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001