<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5033 CA12307 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 70
2 AZT+DDC 35
3 AZT+DDC 26
4 3TC+AZT 83
5 3TC+D4T+NFV 101

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     V35L, T39A, R83K, K103R, K122E, I135T, S162C, G196E, T200TA, E203ED, D218E, A272P, K277R, I293V, E297A  
>CA12307| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIDELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, K20I, D60E, L63P, I64V, V77I  
>CA12589| codons 1-99
PQITLWQRPLVSIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPVEICGHKAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001