<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 496905 Switzerland 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35T, T39ALSV, E40ED, I135V, S162A, K173T, Q174K, T200A, Q207A, R211K  
>496905| codons 29-224
EKIKALTEICVDMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNV
LPQGWKGSPAIFQASMTKILEPFRTKNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRAH
LLKWGFTTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12K, I13V, K14R, G16E, K20I, E35N, M36I, N37D, R41K, I64M, H69K, K70R, L89M  
>496905| codons 1-99
PQITLWQRPVVKVRIEGQLIEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007