<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA645 CA1230 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 78
2 3TC+AZT+SQV 26
3 3TC+AZT+NVP 8
4 3TC+D4T+NFV 17
5 3TC+D4T+NFV+NVP 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   D60E, L63P, V77I  
>CA1230| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V   K103N   I135M, S162C, D177E, G196E, T200TA, R211RG, D237E, V245I  
>CA37710| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPEKWT
VQPIILPEK

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005