<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
111 10324319 Switzerland 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, R41K, L63T, E65D  
>10324319| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QITIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV       V35T, V106VI, K122E, D123E, I142V, I178IM, T200A, Q207E  
>10324319| codons 29-224
EKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGVRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRAKIEELREH
LLRWGFTTPDKKHQKE

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007