<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5 498411 Switzerland 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K49R, V60I, K101R, E169D, D177E, R211K  
>498411| codons 29-224
EKIKALVEICTEMEKEGKISRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILDPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRQH
LLKWGFTTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, N37S, L63P, I64IL, I93L  
>498411| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
von Wyl, V Emergence of HIV-1 drug resistance in previously untreated patients initiating combination antiretroviral treatment: a comparison of different regimen types. Arch Intern Med, 2007