<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5015 CA12286 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 22
2 D4T 31
3 3TC+AZT 22
4 3TC+AZT+IDV 169

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y A62V     K20R, T69S, K122E, I142V, V245R, S251I  
>CA12286| codons 1-291
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDIWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T L24I L10I, I13V, K20KI, E35D, M36I, N37D, R57K, L63P, A71V  
>CA12554| codons 1-99
PQITLWQRPIVTVKIGGQLIEALIDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005