<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OY-05-514 OY-05-514 Tanzania 2005 HIV1 A Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, V35T, V60I, V118I, K122E, D123S, I135T, S162A, K173S, Q174K, D177E, V179I, T200I, Q207A, R211S, F214L, V245Q, D250E  
>OY-05-514| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKES

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, R41K, R57K, L63T, H69K, K70KR, L89M  
>OY-05-514| codons 13-99
VKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQITIEICGKRAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008