<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OY-05-344 OY-05-344 Tanzania 2005 HIV1 A Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14T, I15V, L19I, M36I, N37S, R41K, L63S, H69K, L89M, I93L  
>OY-05-344| codons 13-99
ITVGGQIKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQISIEICGKKAI
GTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75L     P4H, E6K, K11S, V35T, K122E, D123S, I135T, E138EG, K173S, D177E, V179I, Q207A, R211S, V245Q  
>OY-05-344| codons 1-251
PISHIKTVPVSLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDS

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008