<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KW-05-010 KW-05-010 Tanzania 2005 HIV1 A Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, M46X, R57K, L63A, I64M, H69K, L89M  
>KW-05-010| codons 13-99
VRIGGQLKEALLDTGADDTVLEDINLPGKWKPKVIGGIGGFIKVKQYDQIAMEICGKKAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6A, V35T, V60I, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, D250E  
>KW-05-010| codons 1-250
PISPIATVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKE

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008