<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KG-05-372 KG-05-372 Tanzania 2005 HIV1 A Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37D, R41K, K45R, R57K, L63T, H69K, L89M  
>KG-05-372| codons 13-99
VKIGGQLKEALLDTGADDTVLEDIDLPGKWKPRMIGGIGGFIKVKQYDQITIEICGKKAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35T, T39R, K122E, D123S, S162C, S163T, K173S, Q174K, P176S, D177E, V179I, G196E, Q207A, R211K, F214L, V245Q  
>KG-05-372| codons 1-251
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCTMTKILEPFRSKNSEIII
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDS

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008