<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BG-05-700 BG-05-700 Tanzania 2005 HIV1 CRF02_AG Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16A, L19I, M36I, N37D, R41K, H69K, L89M, I93L  
>BG-05-700| codons 14-99
KVAGQIKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIG
TVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V35T, V60I, V118I, K122E, D123S, I135T, E138A, T165TI, K173A, Q174K, V179I, T200A, Q207E, F214L, V245Q  
>BG-05-700| codons 1-251
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDS

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008