<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BG-05-580 BG-05-580 Tanzania 2005 HIV1 D Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, M36I, R41K, I64V, E65D, K70E, I72V L63K, N98NHIL
>BG-05-580| codons 17-99
GQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIKVDICGHEAVGTVL
VGPTPVNIIGRNLLTQIGCTLLF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4PT, V35T, V60I, K122E, A158S, D177E, I178M, T200M, Q207E, R211K, F214X, V245K K73KILQ, V108VL, D113DV
>BG-05-580| codons 1-248
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRQLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTLLDVGVAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRMKIEELREHLLKWGYTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPE

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008