<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BG-05-166 BG-05-166 Tanzania 2005 HIV1 D Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, D60E, L63Q, I64V, I72V  
>BG-05-166| codons 13-99
VKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEQIQVEICGHKAV
GTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, K20R, V35T, T39A, E40D, K49R, V60I, K104R, D121C, K122E, I135T, T139V, S162N, D177E, I178M, Q207E, R211K, V245K, D250E  
>BG-05-166| codons 1-251
PISPIETIPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
CEDFRKYTAFTIPSTNNEVPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKES

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008