<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BG-05-066 BG-05-066 Tanzania 2005 HIV1 A Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35N, M36I, N37D, R41K, R57K, H69K, L89M  
>BG-05-066| codons 13-99
IKIGGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVKQYDQILIEICGKKAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39R, V60I, K122E, D123G, I135T, K173S, Q174K, D177E, V179I, T200A, Q207E, R211K, F214L  
>BG-05-066| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Somi, GR Surveillance of transmitted HIV drug resistance among women attending antenatal clinics in Dar es Salaam, Tanzania. Antivir Ther, 2008