<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D043 D043 Burkina Faso 2003 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13A, K14R, K20I, E35D, M36I, N37D, R41K, H69K, K70R, L89M L63Y, N98Y
>D043| codons 10-99
LVKARIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIYIEICGK
RAIGTVLVGPTPVNIIGRNMLTQIGCTLYF

References
Author Title Citation
Tebit, DM Diversity of HIV in rural Burkina Faso . JAIDS, 2006