<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A543 A543 Burkina Faso 2003 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, L19T, L38V, R41K, R57K, Q61H, L63P, V77I  
>A543| codons 10-99
VVTIKVGGQTKEALLDTGADDTVLEEMNVPGKWKPKMIGGIGGFIKVKQYDHIPIEICGH
KAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tebit, DM Diversity of HIV in rural Burkina Faso . JAIDS, 2006