<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA641 CA1223 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDI 117
3 3TC+AZT 31
4 3TC+AZT+IDV 26
5 3TC+D4T+IDV 27
6 3TC+D4T+RTV+SQV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69AD, M184V, L210W, T215Y       V35M, T39S, K43KE, E44D, V118I, K122E, V179VI, T200A, E203K, Q207D, H208Y, R211K, K223E, L228H, A272P, K277R, T286A, I293V, E297K  
>CA1223| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICSELEEDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIKELRDYLWKWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, V82A, L90LM F53FL L10I, L33MV, N37C, L63P, A71AV  
>CA1222| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIVEEMCLPGRWKPKIIGGIGGLIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005