<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-1351 P1351-664 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 AZT+ DDC 30
3 DDC 109
4 DDC+ SQV 7
5 3TC+ DDC+ IDV 61
6 3TC+ D4T+ NFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y       T27P, E44D, K122E, I135V, S162C, E203D, Q207D, R211K, E224X, F227X, E248D  
>P1351-664| codons 21-249
VKQWPLPEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETP
GIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRT
KIDELRDHLWKWGFYTPDKKHQKXPPLLWMGYELHPDKWTVQPIVLPDK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003