Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-1351 | P1351-1492 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 34 |
| 2 | AZT+ DDC | 30 |
| 3 | DDC | 109 |
| 4 | DDC+ SQV | 7 |
| 5 | 3TC+ DDC+ IDV | 61 |
| 6 | 3TC+ D4T+ NFV | 28 |
| 7 | 3TC+ DDI+ NVP+ RTV | 12 |
| 8 | 3TC | 7 |
| 9 | 3TC+ D4T+ NFV | 20 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, M46I, V82A | M36I, N37ND, K43KI, L63P, A71V |
| >P1351-1492| codons 1-99 PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEIDLPGRWIPKIIGGIGGFIKVRQYD QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |