<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-1351 P1351-1492 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 AZT+ DDC 30
3 DDC 109
4 DDC+ SQV 7
5 3TC+ DDC+ IDV 61
6 3TC+ D4T+ NFV 28
7 3TC+ DDI+ NVP+ RTV 12
8 3TC 7
9 3TC+ D4T+ NFV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A   M36I, N37ND, K43KI, L63P, A71V  
>P1351-1492| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEIDLPGRWIPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003