<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-9877 P9877-665 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 70
2 AZT+ DDC 36
3 3TC 32
4 3TC+ DDI+ IDV 38
5 D4T+ SQV 7
6 DDC+ RTV+SQV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L33F, G73S L10I, E34K, N37D, I62V, L63P, V77I, I93L  
>P9877-665| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFKEMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAISTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35I, T39S, R83K, I135T, S162D, E169D, D177E, I178L, I202V, E203K, Q207E, R211K  
>P9877-665| codons 30-218
KIKALIEICSELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQDSMTKILDPFRKQNPELVIYQYVDDLYVGSDLEIGQHRTKVKELREHL
WKWGFYTPD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005