<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA639 CA1218 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+ DDC 13
3 AZT+ DDI 34
4 3TC+ AZT 21
5 3TC+ AZT+ D4T 13
6 3TC+ AZT+ SQV 17
7 3TC+ D4T+ IDV 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, E35D, M36I, L63P, A71V  
>CA1218| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIVGIGGFTKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       D121Y, K122E, I135V, S162C, T200A, R211K  
>CA1219| codons 31-240
IKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEV
QLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSVNNETPGIRYQYNVLP
QGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLW
KWGFYTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005