<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4914 CA12111 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ D4T 20
2 SQV+ AZT+ RTV 4
3 3TC+ AZT+ NFV+ NVP 9
4 3TC+ NFV+ NVP 16
5 3TC+ NVP 26
6 EFV 8
7 EFV+ ABC 9
8 IDV+ ABC+ 3TC+ RTV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M   L10I, L24F, N37D, L63P, A71V, V77I, I93L  
>CA12111| codons 1-99
PQITLWQRPIVTIKIGGQLKEALFDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLIGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, V75M, M184V, L210W T215C Y181YC, Y188L   K122E, R172RK, I178IM, Q207E, R211K, H221HY, A272P, K277R, T286A, A288AG, V292I K287KT
>CA12022| codons 1-294
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELREHLWKWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003