<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4908 CA12105 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 109
2 AZT+DDI 61
3 AZT+DDI+SQV 61
4 3TC+AZT+NVP 17
5 3TC+AZT+NFV 26
6 EFV+RTV+SQV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M Q58E, G73S L10I, I15V, K20I, L63P  
>CA12105| codons 1-99
PQITLWQRPIVTIKVGGQLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYD
QIPIEICGHKAISTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   V106A, G190A V179D, F227L V35I, K43Q, V118I, D123E, K166R, D177E, G196E, R211K, T286A, I293V, E297K  
>CA12016| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIDI
YQYMDDLYVASDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009