<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA634 CA1209 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDI 157
3 D4T 104
4 AZT+DDC+SQV 13
5 3TC+D4T+IDV 56
6 3TC+NVP 5
7 3TC+AZT+RTV+SQV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D     A98G K43E, E44A, W88C, V118I, K122X, I135V, I142V  
>CA1209| codons 1-158
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DXDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I54T, V82A   L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V, V77I, I93L  
>CA1208| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKIIVGIGGFTKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005