<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1579 CA12073 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 134
2 3TC+AZT 63
3 D4T+DDI+IDV 16
4 3TC+AZT+IDV 16
5 D4T+DLV+RTV+SQV 53
6 3TC+D4T+DDI+NFV+NVP 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, G48V, I54V, V82A, I84IV F53L N37D, L63P, A71V, V77I, I93L  
>CA12073| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIVGIGGLVKVRQYD
QIPIEICGHKVIGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   M230L K238KN K20R, K122E, E138G, D177E, I178L, R211K, H221HY, V245M, I293V, V317A, I329V, Q334L, G359S, A371V, I375IV, A376S, T386I, K390KR, A400T, T403M, A446S, V467I, L491S, S519N, A554ST K281KE
>CA11981| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKYQKEPPFLWLGYELHPDNWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKVSTESIVIWGKIPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGASNRETKLGKAGYVTDRGRQKVISLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005