<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1288 CA12053 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 4
2 3TC+AZT 26
3 3TC+AZT+IDV 43
4 AZT+DDI+IDV+NVP 17
5 3TC+D4T+RTV+SQV 82
6 3TC+D4T+EFV+SQV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V L24I, G73GC L10I, E34Q, N37A, R41K, I62V, L63A, A71V, V77I, I93L  
>CA12053| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLQEMALPGKWKPKMIGGIGGFVKVRQYD
QVAIEICGHKVICTVLIGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N A98AG, P225PH L100LV, K122E, D123N, I135T, I142IL, Q207E, R211K, F214L, V245T K259K*
>CA11962| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGVKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGLRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDQKHQKEHPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQ*LVGKLNWASQIYAGI

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005