<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4123 CA12045 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 NRTI NA
3 DDI NA
4 D4T NA
5 3TC+D4T+IDV 171
6 3TC+AZT+NFV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   E35D, M36I, N37T, Q61E, L63P  
>CA12045| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDITLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       R83K, T200I, Q207NS, E248D, I293V, P294PS  
>CA11956| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVSLTEEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005