<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA632 CA1204 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDC 52
3 AZT+DDI 169
4 D4T 56
5 3TC+AZT 35
6 3TC+AZT+IDV 61
7 3TC+AZT+RTV+SQV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, V82T, L90M   L10R, L63P, A71V, T74TS, V77I, I93L  
>CA1204| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFIKVRQYD
QIPIEICGHKVIGSVLIGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39A, K43A, E44D, V118I, K122E, I142V, Q207E, R211K, I293V, E297A  
>CA1205| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEADGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005