<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4854 CA12034 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 35
2 3TC+AZT+NFV 122

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46ML N88D I13V, N37S, L63P, I64V, V77I  
>CA12034| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMSLPGRWKPKLIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35I, R83K, V90I, K122E, D123DN, I135T, S162H, R211K, F214L, V245E Q258Q*, N265NI
>CA11945| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDI*KLVGKLIWASQIYAGIKVKQLCKLLRGTKALTE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005